PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 916337
Common NameARALYDRAFT_916337
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 470aa    MW: 50748.1 Da    PI: 5.1688
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
916337genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-39145204261
  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
             ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ 
  916337 145 PDKILPCPRCSSMETKFCYYNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKSP 204
             7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-31141202IPR003851Zinc finger, Dof-type
PfamPF027018.4E-32147203IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.444149203IPR003851Zinc finger, Dof-type
PROSITE patternPS013610151187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MADPAIKLFG KTIPLPELAV VVDSCSSYTG VLTETQDQNL VRLSDSCTRD DDDEMGGSGL  60
GGGDDDVGGD GSRGGGESES DKKEDKDNEC QEESLRHESN DVTTNTTSGI TEKTETTKAA  120
KTNEESSQNE TGGTACSQEA KLKKPDKILP CPRCSSMETK FCYYNNYNVN QPRHFCKKCQ  180
RYWTAGGTMR NVPVGAGRRK NKSPASHYNR HVSITSAEAM QKAARTDLQH PNGANLLTFG  240
SDSVLCESMA SGLNLAEKSM LKTQTVLQEP NEGLKITVPL NPSNEEAGTV SPLPKVPCFP  300
GPPPPAWPYA WNGVSWTVLP FYPPPAYWSC PGVSPGTWNS FTWMPQPNSP SGSGPNSPTL  360
GKHSRDENAA EPGATFEETE SLGREKSKPE RCLWVPKTLR VDDPEEAAKS SIWETLGIKK  420
DENADTFGAF RSSTKEKSSL SEGKLPGRRA ELQANPAALS RSANFHESS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0157910.0BT015791.1 Arabidopsis thaliana At5g39660 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002870770.10.0hypothetical protein ARALYDRAFT_916337
SwissprotQ93ZL50.0CDF2_ARATH; Cyclic dof factor 2
TrEMBLD7MJJ70.0D7MJJ7_ARALL; Putative uncharacterized protein
STRINGscaffold_704079.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM137951825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.20.0cycling DOF factor 2